PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_05363
Common NameKK1_005496
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family MYB
Protein Properties Length: 400aa    MW: 45861.6 Da    PI: 9.136
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_05363genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.7e-16101147148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g W +eEd +l+++vk +G + W+ Ia+++  gR +kqc++rw+++l
    C.cajan_05363 101 KGQWNKEEDRKLIRLVKIYGHRKWAEIAEKLE-GRVGKQCRERWNNHL 147
                      799*****************************.*************97 PP

2Myb_DNA-binding46.96.5e-15153195145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      +++W +eE+++lvd +++lG++ W  Ia+ ++ gR+++ +k++w+
    C.cajan_05363 153 KDSWNEEEEKILVDSHARLGNR-WCEIAKLIP-GRSENAIKNHWN 195
                      679*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.04896151IPR017930Myb domain
SuperFamilySSF466892.98E-2798194IPR009057Homeodomain-like
SMARTSM007176.1E-16100149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-26102155IPR009057Homeodomain-like
CDDcd001672.14E-15104147No hitNo description
PfamPF139211.6E-17104162No hitNo description
SMARTSM007171.3E-14152200IPR001005SANT/Myb domain
PROSITE profilePS5129416.579152202IPR017930Myb domain
CDDcd001675.49E-11155195No hitNo description
Gene3DG3DSA:1.10.10.608.2E-19156200IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MDVMVRGGSH GANDFQIYGC ESKPSLTTAI GIDRFLRGHF PHQQQQLAKN NDASVFAEEA  60
LKWTNPNQTP KLCLKDIQVS GKNVKLVGRR SKKHSSVPWI KGQWNKEEDR KLIRLVKIYG  120
HRKWAEIAEK LEGRVGKQCR ERWNNHLRPD IKKDSWNEEE EKILVDSHAR LGNRWCEIAK  180
LIPGRSENAI KNHWNATIRR QNSKRKNKKT KRSNGKPHSS VLEDYIRSKT TSINPKPGII  240
TATDTNLTTT LSQDNAPNPN LNPVFPEPFV NEALFMQQVF MDNNQNHRSL DNVEASKYSS  300
KMCPTPISYL DYCQTNVDDA GECGFVYSLQ YQDNMHLIND SLFPRETHTS HLNYLHSDPY  360
LSHSLNVEPG YGNQNLNIDF RHHGCSQGKA EMDLIEFVSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C6e-441002013104C-Myb DNA-Binding Domain
1mse_C6e-441002013104C-Myb DNA-Binding Domain
1gv2_A8e-441002013104MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-4310020157158MYB PROTO-ONCOGENE PROTEIN
1h88_C4e-4310020157158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006596905.11e-178PREDICTED: myb-related protein A-like
TrEMBLA0A151U0N90.0A0A151U0N9_CAJCA; Transcription factor MYB98
STRINGGLYMA14G37140.21e-176(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41293158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58850.11e-53myb domain protein 119